Dimensions: 128mm (L) x 86mm (W) x. High sample correlation coefficients (R 2) make it easy to. 312 gain calibration failed. Lids for a case of 200 microplates must be purchased separately. Description Control Panel Cuvette Chamber Back Panel Microplate Drawer The Control Panel TEMP on/off TEMP Figure 1. Fluorescence filters included in 1nm range. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. Fluorescent Polarization: Solid black plates, as above. Company Molecular Devices LLC. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. 6 (H) x 22. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold increase in throughput for medium throughput and secondary screening laboratories. The adapter isThe SpectraMax Paradigm Multi Mode Detection Platform utilizes a patent pending design that allows for real time system configuration by the user in less than two minutes. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. 313 reference gain check fail. For more sample throughput, the system can be. SpectraMax340PC384reads96-wellplatesand384-wellplates. ¨The SpectraMax M2 is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. The standard 8 filter modes enable endpoint and kinetic applications such as protein quantification, cell viability and ELISA. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. Multimode Readers Comparison Chart. UV/Vis spectrophotometer & microplate reader with built-in cuvette port. Reads standard cuvettes & 96-384 well plates from 190 to 1000 nm. 과 같은 Parameter를 검사하여 평가할 수 있습니다. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. microplates or in a cuvette at a. 5 pg/µL to 200 ng/µL. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export data The SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Browse for different fluorescent readers below and compare across different instrument suppliers. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with. SpectraMax iD3 and iD5 Register or Sign In. 003 fmol 0. Community forums for Molecular Devices - SpectraMax 340PC384 Microplate Reader relating to Fatal Error 401 on LabWrench. 1) All parts of the SPECTRAmax 340PC 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. Perform your favorite applications with a user-friendly reader that accommodates plate types from six to 384-well formats; up to. SpectraMax 340PC384: SpectraMax Plus384: VERSAmax: Vmax: Tecan: Sunrise: Trinean: DropSense96: AMBIENT TEMPERATURE STORAGE: Liconic: LPX 220 Hotel: LPX 440 Hotel:. The SpectraMax ABS Plus Microplate Reader can run both cuvette-based and microplate based reader applications on the same instrument. Service parts for these models are not being produced and are no longer in stock. If using a microplate, place it in the drawer of the SPECTRAmax PLUS, then read the plate. The optical system of the SpectraMax 190 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 850 nm). The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. Here, the CVs for each plate were less than 3, and the difference between mean onset time for the plates run on the two readers was only 7%. The SpectraMax Paradigm Multi-Mode Detection. Figure 1. Also see:. Computer and software not available. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time resolved fluorescence assays (TRF). When reading optical density at wavelengths below 340 nm,. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. Page 10 Cuvette Chamber The cuvette chamber on the SpectraMax Plus 384 is located at the right front of the instrument. Each sample has a discrete sample beam and reference beam. We would like to show you a description here but the site won’t allow us. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Open the catalog to page 2. 012 fmol 0. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. We have a great online selection at the lowest prices with Fast & Free shipping on many items!384-well (75 µL) 0. SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence. ester flash assays, in both 96- and 384-well plates. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. Molecular Devices SpectraMax Plus 384. ) 8. Temperature control and microplate-shaking included. Paradigm spectramax manualslibSpectramax id5 Molecular devices spectramax plus 384 user manual pdf downloadShaking spectramax id3 frequently. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. SpectraMax iD5. This integrated system. no. Typical applications for this powerful reader include DNA and RNA quantification. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength. Cell viability는 세포막 Integrity 또는. In the M2, M5 and Plus 384, the light. SpectraMax M series, Gemini, and SpectraMax iDx readers have xenon flash lamps,. SpectraMax i3x Multi-Mode Microplate Reader. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. . The optical performance is comparable to a top-of-the-line dedicatedSpectraMax 340PC384的光学设计真实地模 拟双光束分光光度计。每个孔有其各自的 样品光束检测和参比检测。8通道的系统, 包含8条样品检测光束和8条参比光束,给 予出众的精确度和高速读板方式。 不需要滤光片 SpectraMax 340PC384使用光栅单色器代替 滤光片。Explore more about Optimized settings for Transcreener TR-FRET assay on SpectraMax iD5 and SpectraMax i3x readers. Set up SoftMax Pro Software to use PathCheck as detailed above. Molecular Devices Spectramax 384 Plus Microplate Reader. The SpectraMax® and VersaMax™ require proper ventilation to keep their internal components cool. Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. Microplates for applications that require high sample recovery rates. Categories:. Trilux 1450 Microbeta Liquid Scintillation and Luminescence Counter, Wallac (CAT#: STEM-SPO-0385-ZJF) Dynex MRX TC Revelation Microplate Reader, 100-240V, Dynex Technologies (CAT#: STEM-SPO-0076-YJL)The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. 1 Figure from 528 Publications Molecular Devices LLC. DNA provides the same sensitivity as a spectrophotometer. , FI 45 sec. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. ) gap between the rear of the instrument and the wall. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. spectramax, i3x, spectramax i3x, detection cartridge, spectramax i3x injector cartridge, smartinject technology, atp a, spectramax i3x multi-mode microplate reader, luminescent cell. SpectraDrop Micro-Volume Refills, 24-Well Bottom Slides. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. Table 2. Detection modalities are shown in Table 1-1. Features demonstrated by the model include temperature control, a robot-compatible interface and data analysis software. TNF standard curve. Also refer to this Multimode Reader Comparison Chart. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. Shaker time 0 to 999 seconds Temperature control Ambient. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. com. Page 78 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. The optical system of the SpectraMax 340PC384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. to View Figures. 0200-6263. High-precision 9 channel system; filter-less with up to 6 wavelengths. Three low volume 24-well bottom slides. Clearance . Which SpectraMax Multi-Mode Microplate Reader do you need? Detection Modes Absorbance Fluorescence Intensity Luminescence Time-Resolved Fluorescence Fluorescence Polarization HTRF Upgrade Options Plate Formats 6-, 12-, 24-, 48-, 96-, 384-Well Microplates Certification and Validation IMAP Validation (TR-FRET only) (TR-FRET. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. Wavelength Range. Read up to 6 wavelengths in endpoint or kinetic mode for 96- and 384-well plates, and perform spectral scans to determine. 2 SpectraMax MiniMax300ImagingCytometer(cytometer) 3. Glad to help you. Molecular Devices SpectraMax i3 Multi-Mode Microplate Reader Pred i3x - AV $14,995. SpectraMax and VersaMax Plate Readers OperatorÕs Manual Ñ 0112-0126 Rev A SpectraMax Plus 384 SpectraMax 190 SpectraMax 340PC 384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. For high-range or. Perform the following steps to install the drivers: Start > Control Panel > System. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. The . Related Products: SpectraMax 384 Plus UV/Vis Microplate Reader, Molecular Devices SpectraMax M2e Microplate Readers, Molecular Devices SpectraMax M5 Multi-Mode Microplate Reader,. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. SpectraMax Plus 384 Spectrophotometer from Molecular Devices LLC. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. Measurement of tannin, iron-reactive phenolics, anthocyanin and polymeric pigment in red wine is an important part of quality control in the wine industry. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. Reliable performance with a proven track record. Videos & Webinars. Assay setup for a 384-well low-volume plate. With its dual high-velocity liquid injectors, SpectraMax L can perform both flash and glow luminescence detection applications in 96- and 384-well formats with ease. no. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurements in the visible range. Fixed a problem where Column Priority rather than AutoRead was available in the SpectraMax 384 instrument setup. Light Source: Xenon flash lamp. SpectraMax M2e Plate Reader; Application: Absorbance Concentration of Nucleic Acid: Fluorescence Concentration of RNA or DNA: Absorbance, Florescence, Luminescence RNA, DNA, Proteins: Range: 10ng-3000 ng (Accuracy diminishes less than 20 ng/µl and above 1500 ng/µl) RNA Broad Range: 20-1000 ng RNA: 5-100 ng DNA Broad Range: 2. Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). ester flash assays, in both 96- and 384-well plates. 5 mP 6 mP * For properly functioning, operated, and maintained equipment. We would like to show you a description here but the site won’t allow us. 1. The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. It provides ready-to-run protocols, analysis algorithms, and 21 different curve fit options. Wavelength Selection: Monochromator, tunable 1. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. Microplate spectrophotometers, also called microplate readers, allow researchers to analyze multiple samples in parallel using 6- to 1536-well formats, as opposed to single sample measurements. 美谷分子 SpectraMax Plus 384 微孔板读 板机对于进行葡萄酒中苹果酸的酶学定量 检测是很好的一个选择,也可以扩展到类 似的实验,包括氨和挥发性酸度的测定。 这对于花费和时间都是高效的。 SpectraMax Plus 384 微孔板读板机的可 调谐和光径检测传感器特性有助于. The SpectraMax M5e Reader offers the additional benefit of being certified for Cisbio Bioassays’ HTRF® Assays. Read one sample or up to 384 at a time – it’s your choice. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. Manufacturer: Molecular Devices Model: SpectraMax Plus 384 The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Published Dec 16, 2020 | Updated Dec 16, 2020. reader in the visible range between 405–750 nm with NIST and NMI. Cables. Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. This reader also makes use of a unique temperature. Typically the system can detect absorbance, luminescence, fluorescence, and even make more specialized fluorescence measurements like time-resolved fluorescence (TRF) and fluorescence polarization (FP). For more sample throughput, the system canTo provide access to disconnect power from the instrument, maintain a 20 cm to 30 cm (7. The light transmittance was evaluated as function of wavelength of the BNC membranes. The SpectraMax® L Microplate Reader measures flash and glow luminescence assays in both 96- and 384-well plates. Features. Detection modalities include absorbance (UV-Vis. The guidelines for cuvette use in SpectraMax instruments are the same as those that apply to any high-quality spectrophotometer. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Features. It may be named "Pothos". , FI 45 sec. The manufacturer of Molecular Devices Spectramax Plus 384 Microplate UV/VIS Reader is Molecular Devices. The SpectraTest ABS1 plate is a reliable and. Shaker time: 0 to 999 seconds Temperature control: Ambient +4°C to 45°C Temperature. Easy-to-use, robust assay kits for. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. 003 fmol 0. spr SpectraMax iD3 SpectraTest ABS2 v1. The PathCheck Sensor is a temperature independent feature from Molecular Devices that measures the optical pathlength of samples in microplate wells. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. The low profile increases robotic stack capacity and storage. Each SpectraMax® 340 PC 384 Microplate Reader has an. Molecular Devices recommends that you use high-quality, doubleshielded cables to connect your SpectraMax. 8 (W) x 15 (D)SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. The 190 can read across the entirety of the UV-Vis. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. SpectraMax190reads96-wellplates. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. Detection modalities are shown in Table 1-1. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI). 96 / 384 Head: Fixed Pin Tool - 384 Head: Grippable Pin Tool - 96 / 384 Head: Magnetic Pin Tool - 96 / 384 / 1536 Head: LUMINESCENCE MICROPLATE. SpectraMax Plus 384 reads 96-well plates, 384-well plates, and cuvettes. ® reader to the computer. Multimode Reader Comparison Chart. Insert the snorkel into the bottle and then insert the snorkel into the snorkel clamp. Minimum volume and maximum throughput with 96- or 384. Place the microplate on or remove it from the microplate drawer. Features. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. SpectraMax L Microplate Reader is a sensitive luminometer with programmable injector options that measures flash and glow luminescence assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) in 96- and 384-well plates. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes. Molecular Devices Spectramax 384 Plus Microplate Reader is available from The Lab World Group. View and Download Molecular Devices SPECTRAmax PLUS 384 operator's manual online. 2 or higher, standard edition only, no GxP) VersaMax™ Microplate Reader (Serial numbers begining with BNxxxxx and BNRxxxxx are supported) SpectraMax® 190 Absorbance Microplate Reader (Serial numbers. More Product Information. 더 많은. The microplates were read the next day from the bottom and the top in SpectraMax M5 and Gemini EM readers. On LabX buyers can find a variety of SpectraMAX models for sale: 190, 384, 340 and the SpectraMAX M series. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. Regularly used for NADPH ATPase assays, and BCA assays. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. used. The SpectraMax 340PC384 system has a monochromator instead of interference filters. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. SpectraMax® M2 Multi-Mode Microplate Reader MLDVM2 SpectraMax® M2e Multi-Mode Microplate Reader (top and bottom reading) MLDVM2E SpectraMax® M3 Multi-Mode Microplate Reader MLDVM3 Ordering information VWR cat. Sold as-is. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on. Read one sample or up to 384 in a single plate eead using any standard cuvette, or 96-or 384-well microplate. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. Use any standard cuvette, 12 x 75 mm testThe SpectraMax Mini Multi-Mode Microplate Reader is a budget friendly solution. Chapter 1: General Information. Page 19: Plate Adapter SpectraMax M2 and M2e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. The reader is ideal for measuring flash and glow assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) via aequorin, bioluminescence resonance energy transfer (BRET), and acridinium ester flash assays, in both 96- and 384-well plates. If desired, a high-range standard curve may be prepared from 1 ng/mL to 1 μg/mL, or a low-range standard curve may be prepared from 25 pg/mL to 25 ng/mL. Avantor is setting science in motion for a better world | Avantor - VWROverview of 384-Well High Sample Recovery Plate. 1. The AlphaScreen Detection Cartridges utilize a 680nm Laser Diode to provide a sensitive reading system for AlphaScreen assays. Item SpectraMax Plus 384 Microplate Spectrophotometer; Company Molecular Devices LLC; Catalog Number SpectraMax Plus 384; This product is no longer available on Biocompare. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. spr * SpectraMax i3(x) SpectraTest ABS2 v1. 0. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a variety of assays. GETTING THE MOST FROM YOUR MOLECULAR DEVICES MICROPLATE SYSTEMS applications guide to microplate systems applications guide to microplate systemsSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. For more information, please visit us at Devices – Spectramax Gemini XS plate reader (Fluorescence) Molecular Devices – Spectramax 384 plus plate reader (UV/VIS) Invitrogen by Life technologies Qubit 2. Microplate Readers include the M3, M4,. Monochromator, tunable 1. SUPPORTED PLATES Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2e. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. the SpectraMax iD3 is a fantastic plate reader for a wide range of assays. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). A & K Biosource are the pros on this, but these plate readers are quite expensive to repair/calibrate. 384 distinct wells in a source plate to a read plate, simultaneously. Figure 1. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . SpectraMax M2, M2e; SpectraMax M3, M4, M5, M5e; FilterMax™ Multi-Mode Detection Platform. 0. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v1. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Eight different automated tests are provided: • Absorbance accuracy (linearity) • Precision (reproducibility) • Stray light • Wavelength accuracy • Wavelength repeatabilityThe SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. Computer and software not available. SpectraMax® Plus 384 Absorbance Plate Reader, Molecular Devices. Validating the absorbance optical performance of your microplate reader is as simple as reading a plate. Version7. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. The SpectraMax® M2 and M2e Systems from Molecular Devices are multidetection microplate readers with dualmonochromators, dual-mode cuvette ports, and top- and bottom-reading capability (top-reading only on the M2). Wavelength Selection: Monochromator, tunable 1. Download PDF versions of the SpectraMax Microplate Reader User Guides. The reader adds up to three transfers of assay reagents from a 96- or 384-well source plate to enhance assay design using integrated fluidics. In addition, users can define individual reagents and concentrations to be delivered to eachMolecular Devices Microplate Reader Spectramax 384 340PC. Thermo LTQ Orbitrap Velos LC/MS System. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. The SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. Pick the best speed, sensitivity, and price for your needs. Published Dec 16, 2020 | Updated Dec 16, 2020. SPECTRAmax PLUS Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific pro-teins, nucleic acids, and other molecules across a wide range of concentrations. SpectraMax ABS Plus SpectraTest ABS2 v1. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and analysis. 3) This warranty covers the SPECTRAmax PLUS 384MOLECULAR DEVICES SPECTRA max PLUS 384 Microplate Reader from Bid On Equipment. Statistics. Combines UV/Vis spectrophotometer and microplate reader. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. Mode 96-well 384-well 1536-well Optimizedforspeed 12seconds 25seconds 50seconds Optimizedforperformance 20seconds 40seconds 80seconds Table1-1:PlateReadTimesforOn-the-FlyDetection(± 5. Optimal volumes are usually stated as 'working volume', which is 25 - 90 mL. com Check our website for a current listing of worldwide distributors. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Clamp for injector 1 is on the left and clamp for injector 2 is on the right. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. Molecular Devices SpectraMax 384 Plus Microplate Reader. 2. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. spectraMax 340pc 384 Microplate reader. used. 384 wells) and the "Select Specific" menu to choose the specific plate type. 1. Temperature range between 4°C above ambient to 45°C. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Light Source: Xenon flash. Page 1The Molecular Devices SpectraMax M2 Microplate Reader is a multidetection microplate reader with dualmonochromators, dual-mode cuvette ports, and top-reading capability. For more sample throughput, both readers can be easilySpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54)SpectraMax190,340PC384,Plus384,VersaMaxMicroplateSpectrophotometersUserGuide 8 0112-0126D ComputerIntegration. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurement in the visible range. SpectraMax i3x Injector Cartridge with SmartInject® Technology. Detects signal from either fluorescence or luminescence based assays. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Beer-Lambert Law states that. It can be upgraded with modules such as imaging cytometer, western blot imager, and injectors to expand its capabilities. The light should fall square on the slit. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. SpectraMax iD3 reader with touchscreen and inserted USB flash drive. Molecular Devices SpectraMax 384 Plus Microplate Reader. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. SpectraMax ® Plus 384 optics. 9 in. 1. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in absorbance, fluorescence, luminescence, time-resolved fluorescence (TRF), and tunable fluorescence polarization (FP) read modes. The value for 1000 should be higher than the value for 900. No accessories are needed and SoftMax® Pro Software. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. The control panel consists of a 2-x-20-character LCD and eleven pressure-sensitive membrane keys that can be used to control some functions of the instrument. Monochromator wavelength selection saves you the time and trouble of ever having to change out filters. If using test tubes, read the absorbance of each tube in the cuvette port of the SPECTRAmax PLUS microplate spectrophotometer. Qualify the absorbance performance of SpectraMax® iD3, iD5, i3, i3x, M2, M2e, M3, M4, M5, M5e, Plus 384, ABS, ABS Plus, and FlexStation 3 readers. Both the SpectraMax M5 and the Gemini EM are monochromator-based, microplate readers. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. The optical performance is comparable to a top-of-the-line dedicated Unparalleled performance on a personalized platform. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. 세포신호전달은 세포가 환경에 반응하고 다른 세포와 소통할 수 있게 합니다…. 96/384-FortheSpectraMax340PC384,presstoselecttoreada96-wellplateora384-wellplate. The SpectraMax Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Detection modalities are shown in Table 1-1. Our microplate readers and software are the industry’s most cited and have empowered life science researchers to advance protein and cell biology. Biocompare is the leading resource for up-to. QuickSync. Set up SoftMax Pro Software to use PathCheck as detailed above. to View. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. 384 wells: Abs 49 sec. Instrument Description and Capabilities: Fluorescence. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. both cuvette-based and microplate reader applications on the same instrument. 25 µL/well in a 384-well plate, using AlphaScreen Phosphotyrosine (PT66) Assay Kit 0200-7017. 1, All Necessary Cables and Cords, Manuals. Total volume (except deep. E = absorptivity (extinction coefficient) C = concentration = pathlength. .